DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARL1

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_009723.3 Gene:ARL1 / 852462 SGDID:S000000368 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:80/164 - (48%)
Similarity:119/164 - (72%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWKN 80
            ||.|||:||||.|||||||.:|...::.|..||.|||:::::....||||||:|||..|||||:.
Yeast    17 KELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRC 81

  Fly    81 YFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSL 145
            |:|:|..:|:|:|.||:.|:..|..||..||.:..|:...:|:||||||.|.|:||:||:::::|
Yeast    82 YYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNL 146

  Fly   146 VQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMKK 179
            |:|:.|:|.|.|.:|:.|.|:.||:||:...:|:
Yeast   147 VELKDRSWSIVASSAIKGEGITEGLDWLIDVIKE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 79/159 (50%)
ARL1NP_009723.3 Arl1 20..177 CDD:206718 77/156 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.