DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARF2

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_010144.1 Gene:ARF2 / 851418 SGDID:S000002296 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:81/180 - (45%)
Similarity:118/180 - (65%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLRKLRPN--PEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKL 63
            |||.:  .||..|  ..||.|||::|||.|||||:|.:|...::.|..||.|||:::|.......
Yeast     1 MGLYA--SKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISF 63

  Fly    64 NVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQ 128
            .|||:|||.:||..|::|:.||:.:|:|||..||:|:.||...:..||.::.|:....|:|||||
Yeast    64 TVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

  Fly   129 DMPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            |:|:||||||:.||:.|..::.|.|.|::..|..|.||.||::|:..|:|
Yeast   129 DLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 77/174 (44%)
ARF2NP_010144.1 ARF 5..179 CDD:128474 78/176 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.