DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARFD1B

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_171745.3 Gene:ARFD1B / 839242 AraportID:AT1G02430 Length:190 Species:Arabidopsis thaliana


Alignment Length:176 Identity:66/176 - (37%)
Similarity:104/176 - (59%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKEARILLLGLDNAGKTTILKQL-ASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQ--WKIRP 76
            ::|:||:|.|||.|||::|:.:| ..|.:||..||.|.:::||......|..|::|||  :|..|
plant    15 QEESRIVLFGLDAAGKSSIMHKLKTGETLTTTMPTIGTDVESVKYKDSNLRFWEMGGQQCYKWFP 79

  Fly    77 YWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVP----VLIFANKQDMPDAMSAA 137
            ..|:.|.....|:.|:|.|||.|:.:| .:....::|.....||    ||:|.||.::|.||||:
plant    80 MTKHDFQEIAGLVLVVDSTDRDRIEDA-KDFLNAVIDEIQGSVPDNVAVLVFGNKHEVPGAMSAS 143

  Fly   138 EVAEKMSLVQLQ----GRTWEIKACTAVDGTGLKEGMDWVCKNMKK 179
            |::.|:.|..|:    .|.|.:::..|..|.||.||:||:.||.::
plant   144 EISNKLDLTSLRQKNWQRNWHVQSSCAFSGDGLHEGLDWLLKNAER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 64/171 (37%)
ARFD1BNP_171745.3 Arf_Arl 19..186 CDD:206644 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.