DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARF3

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_850057.1 Gene:ARF3 / 817014 AraportID:AT2G24765 Length:182 Species:Arabidopsis thaliana


Alignment Length:163 Identity:80/163 - (49%)
Similarity:107/163 - (65%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWKN 80
            ||||||:||||||||||||.:|...::.:..||.|||:::|..:..|..|||:|||..|||||:.
plant    16 KEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRC 80

  Fly    81 YFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSL 145
            ||.||..:|||:|.:|..|:..|..|...:|.::.||...|||||||||:|.|:..|.|.|.:.|
plant    81 YFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALEL 145

  Fly   146 VQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            .:::.|.|.|....||.|.||.||:||:...:|
plant   146 HKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 79/159 (50%)
ARF3NP_850057.1 Arl1 19..176 CDD:206718 76/156 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.