DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARFB1A

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_179133.1 Gene:ARFB1A / 816020 AraportID:AT2G15310 Length:205 Species:Arabidopsis thaliana


Alignment Length:160 Identity:77/160 - (48%)
Similarity:106/160 - (66%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYW 78
            |:.:.|||::|||.:||||||.:|...::.|..||.|||:::|...|....|||||||.|||..|
plant    14 PKSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTVWDIGGQEKIRKLW 78

  Fly    79 KNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKM 143
            ::||.|...||:|:|.:|..||.||.:||..:|.||.|:...||:||||||..:|:..||||.|:
plant    79 RHYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDSRNALPVAEVANKL 143

  Fly   144 SLVQLQGRTWEIKACTAVDGTGLKEGMDWV 173
            .|..|..|.|.|:..:|:.|.||.||::|:
plant   144 GLHSLSKRCWLIQGTSAISGQGLYEGLEWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 77/160 (48%)
ARFB1ANP_179133.1 P-loop_NTPase 1..180 CDD:304359 77/160 (48%)
Ras 19..179 CDD:278499 76/155 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.