DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and Arl13b

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_080853.3 Gene:Arl13b / 68146 MGIID:1915396 Length:427 Species:Mus musculus


Alignment Length:178 Identity:61/178 - (34%)
Similarity:102/178 - (57%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIG 69
            :|.::.| .|.::..::::||||||||...|.:..|....|.||.||:...:....|::.::|:|
Mouse    10 NLFKRWR-EPVRKVTLVMVGLDNAGKTATAKGIQGEHPEDVAPTVGFSKIDLRQGKFQVTIFDLG 73

  Fly    70 GQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAM 134
            |..:||..||||:|.:..:|:|:|.:|..|:.|....:.|:|...|:...|:|:.|||||...|:
Mouse    74 GGKRIRGIWKNYYAESYGVIFVVDSSDEERMEETKETMSEVLRHPRISGKPILVLANKQDKEGAL 138

  Fly   135 SAAEVAEKMSLVQLQGR---TWEIKACTAVDGTG------LKEGMDWV 173
            ..|:|.|.:||.:|...   ..:|:.|:||.|.|      :|:|:.|:
Mouse   139 GEADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 61/178 (34%)
Arl13bNP_080853.3 Arl2l1_Arl13_like 23..189 CDD:133361 58/164 (35%)
Ras 24..172 CDD:278499 54/147 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.