DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and SAR1A

DIOPT Version :10

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_064535.1 Gene:SAR1A / 56681 HGNCID:10534 Length:198 Species:Homo sapiens


Alignment Length:171 Identity:53/171 - (30%)
Similarity:87/171 - (50%) Gaps:12/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWK 79
            :|..:::.||||||||||:|..|..:.:....||.....:.:...|.....:|:||..:.|..||
Human    23 KKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWK 87

  Fly    80 NYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAE--- 141
            ||....:.:::::||.|.:||.|:..||..::.|..:..||:||..||.|..||:|..::.|   
Human    88 NYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFG 152

  Fly   142 ---------KMSLVQLQGRTWEIKACTAVDGTGLKEGMDWV 173
                     .::|.:|..|..|:..|:.:...|..||..|:
Human   153 LYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 53/171 (31%)
SAR1ANP_064535.1 Sar1 3..197 CDD:206645 53/171 (31%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.