DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and Arl3

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_062692.1 Gene:Arl3 / 56350 MGIID:1929699 Length:182 Species:Mus musculus


Alignment Length:177 Identity:114/177 - (64%)
Similarity:145/177 - (81%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNV 65
            |||||:||||:..|::|.||||||||||||||:|||||||||:.:|||.|||||||.:.||||||
Mouse     1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNV 65

  Fly    66 WDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDM 130
            ||||||.||||||::||.|||:||||||..||.|..|.|.||.|:|.:.:|..|||||||||||:
Mouse    66 WDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDL 130

  Fly   131 PDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNM 177
            ..|..|:|:||.::|..::.|.|:|::|:|:.|.|:::||:|||||:
Mouse   131 LTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 110/172 (64%)
Arl3NP_062692.1 Arl3 3..176 CDD:206721 110/172 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2383
eggNOG 1 0.900 - - E2759_KOG0074
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48276
Inparanoid 1 1.050 242 1.000 Inparanoid score I3310
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56336
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0003664
OrthoInspector 1 1.000 - - oto93633
orthoMCL 1 0.900 - - OOG6_104284
Panther 1 1.100 - - LDO PTHR45697
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2406
SonicParanoid 1 1.000 - - X2537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.