DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arf4b

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001017707.1 Gene:arf4b / 550402 ZFINID:ZDB-GENE-050417-205 Length:180 Species:Danio rerio


Alignment Length:165 Identity:72/165 - (43%)
Similarity:110/165 - (66%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWK 79
            :||.|:|::|||.|||||:|.:|...::.|..||.|||:::|........|||:|||..||..|:
Zfish    15 KKEMRLLMVGLDAAGKTTVLYKLKLGEVVTTIPTLGFNVETVEYRNISFTVWDVGGQDIIRRLWR 79

  Fly    80 NYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMS 144
            :|:.||..||:|:|.:||.|:..|..||..||.::.::...:|:.|||||:|.||:|.|:.|::.
Zfish    80 HYYQNTKGLIFVVDSSDRDRIETAAEELKMMLAEDEMRDAVLLVLANKQDLPKAMAAHELTERLG 144

  Fly   145 LVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMKK 179
            |..|:||.|.:::..||.|:||.||:||:...:.|
Zfish   145 LHALRGRQWFVQSTCAVQGSGLYEGLDWLTDQLSK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 71/160 (44%)
arf4bNP_001017707.1 P-loop_NTPase 1..180 CDD:304359 72/165 (44%)
SAR 15..174 CDD:197556 71/158 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.