DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl1

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001016396.1 Gene:arl1 / 549150 XenbaseID:XB-GENE-961332 Length:181 Species:Xenopus tropicalis


Alignment Length:163 Identity:79/163 - (48%)
Similarity:110/163 - (67%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWKN 80
            :|.|||:||||.|||||||.:|...::.|..||.|||:::|.....|..|||:|||..|||||:.
 Frog    16 REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRC 80

  Fly    81 YFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSL 145
            |::|||.:|||:|..||.|:..:.|||..||.:..||:..:::|||||||..||:..|||..:.|
 Frog    81 YYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELKKAILVVFANKQDMEQAMTPTEVANSLGL 145

  Fly   146 VQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            ..|:.|.|:|...:|..||||.|.|:|:.:::|
 Frog   146 PALKDRRWQIFKTSATKGTGLDEAMEWLVESLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 78/159 (49%)
arl1NP_001016396.1 Arl1 19..175 CDD:206718 77/155 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.