DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl14

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001015791.1 Gene:arl14 / 548508 XenbaseID:XB-GENE-5750500 Length:201 Species:Xenopus tropicalis


Alignment Length:165 Identity:67/165 - (40%)
Similarity:105/165 - (63%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAAD-GFKLNVWDIGGQWKIRPYWK 79
            |:||||:||||:|||:|:|.:...::.....||.|||::.:..: ..:|.:||:|||.|:|.:|.
 Frog    12 KQARILILGLDDAGKSTVLYKFKFKEPFITIPTVGFNVEMIHTEKHLQLTMWDVGGQQKLRSFWC 76

  Fly    80 NYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMS 144
            :||.|||.|:||:|..|...|.|:..|...:|.:..:|.|||::.|||||:|.|::|.|:..|.:
 Frog    77 HYFENTDGLVYVVDSNDSKHLDESKKEFQHVLQNELIKDVPVVLLANKQDLPGALNAEEITRKFN 141

  Fly   145 LVQ-LQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            :.: ...|.|.::.|.|..|.||.||:..|.:.:|
 Frog   142 MKKYCSDRDWYVQPCCAHTGQGLAEGLSKVTEFVK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 66/161 (41%)
arl14NP_001015791.1 ARLTS1 15..174 CDD:133356 64/158 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.