DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arfrp1

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_005166227.1 Gene:arfrp1 / 503602 ZFINID:ZDB-GENE-050227-14 Length:201 Species:Danio rerio


Alignment Length:166 Identity:58/166 - (34%)
Similarity:97/166 - (58%) Gaps:10/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILLLGLDNAGKTTILKQLASE--------DITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRP 76
            ||:||||||||||.|:|..:.        :::.:|.|.|.||.::.....:|..||:|||.:::.
Zfish    20 ILILGLDNAGKTTFLEQTKTRFSKNYKGMNLSKITTTVGLNIGTIDVGKARLMFWDLGGQEELQS 84

  Fly    77 YWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAE 141
            .|..|:|.:..:|||||.||..||.|:.:...:|:....|:.||:|:.|||||:.:.:|..::..
Zfish    85 LWDKYYAESHGVIYVIDSTDEERLGESKNAFEKMISSEALEGVPLLVLANKQDVENCLSVPDIKT 149

  Fly   142 KMS--LVQLQGRTWEIKACTAVDGTGLKEGMDWVCK 175
            ..|  ..::..|...::.|.|:.|.|:.:|::|:.|
Zfish   150 AFSDCAPKIGKRDCLVQPCAALSGQGVNDGIEWMVK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 58/166 (35%)
arfrp1XP_005166227.1 Arfrp1 19..186 CDD:206725 58/166 (35%)
Ras 20..189 CDD:278499 58/166 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.