DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and Sar1

DIOPT Version :10

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster


Alignment Length:126 Identity:30/126 - (23%)
Similarity:45/126 - (35%) Gaps:27/126 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 IRCTPDWSENAVSGDHLWVPTSVSGDCCCVGDNECTKHGPRMKCAACKIIAHASCISVLMERSH- 697
            ||..|...:..:|.|...:.||.|.     .|:...:.|.|.:......:|....|..:...:| 
  Fly    25 IRLMPSRLQKTLSIDGDLITTSASD-----VDHITMELGQREQLMEDNPVAEQLRIETIKSIAHK 84

  Fly   698 LQCKPTFRDVGVRQYREQTKTTHHWVHRRTEKGKCKQCGKVSGTKMSLQAKLTFSSKEIVA 758
            :..|        ||.|||...|   ||||..:.|          .:.|..:..:.:|..||
  Fly    85 ISTK--------RQIREQLART---VHRRATRAK----------SIGLLRRYRYGAKRYVA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721
Sar1NP_732717.1 Sar1 2..192 CDD:206645 30/126 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.