DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and Arl2

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:179 Identity:84/179 - (46%)
Similarity:119/179 - (66%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNV 65
            ||.|::|:|:| ..|:|.|||||||||||||||||:...|.|.|::||.|||||::..:|:.||:
  Fly     1 MGFLTVLKKMR-QKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNM 64

  Fly    66 WDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDM 130
            ||:|||..:|.||:|||.:||.|::|:|..||.||...|.||..:|.:.||....:|:..||||:
  Fly    65 WDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDL 129

  Fly   131 PDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMKK 179
            |.|:|:.|:.|.:.|..:....|.:...:||.|..|...|||:..::.|
  Fly   130 PGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 81/172 (47%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 81/172 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117080at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45697
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.