DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and Arl8

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:93/172 - (54%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKEARILLLGLDNAGKTTILKQLAS----EDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIR 75
            ::|..:.|:||..:||||.:..:||    ||   :.||.|||::.:......:.|||||||.:.|
  Fly    18 KEEMELTLVGLQFSGKTTFVNVIASGQFAED---MIPTVGFNMRKITRGNVTIKVWDIGGQPRFR 79

  Fly    76 PYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVA 140
            ..|:.|....:.::|::|..|..:|..:.:||..:|...:|..:|||:..||:|:|.|:....:.
  Fly    80 SMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLI 144

  Fly   141 EKMSLVQLQGRTWEI----KACTAVDGTGLKEGMDWVCKNMK 178
            |:|:|..:|.|  ||    .:|...|...:.  :.|:.::.|
  Fly   145 ERMNLSSIQDR--EICCYSISCKEKDNIDIT--LQWLIQHSK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 53/168 (32%)
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 52/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.