DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl3l2

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_957013.1 Gene:arl3l2 / 393692 ZFINID:ZDB-GENE-040426-1678 Length:187 Species:Danio rerio


Alignment Length:176 Identity:104/176 - (59%)
Similarity:137/176 - (77%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVW 66
            ||||:::||:.:.|.|.||||||||||||||:||.|||||:.|:|||.|||||:||:.|.|||||
Zfish     7 GLLSVMQKLKGSSELELRILLLGLDNAGKTTLLKSLASEDVNTITPTQGFNIKTVASRGMKLNVW 71

  Fly    67 DIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMP 131
            |||||.||||:||.|..|||:|:||||..|:.|..|.|.||.|::.:..|..|||||||||||:.
Zfish    72 DIGGQRKIRPFWKKYLENTDLLVYVIDSADKKRFEETGLELSELIDEENLCGVPVLIFANKQDLG 136

  Fly   132 DAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNM 177
            .|..|:|:||.::|...:.|.|:|:||:|:.|.|:::||:|:|.|:
Zfish   137 TAAPASEIAEGLNLHTYRDRVWQIQACSAITGEGVQDGMNWICNNL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 102/172 (59%)
arl3l2NP_957013.1 Arl3 8..181 CDD:206721 102/172 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2294
eggNOG 1 0.900 - - E2759_KOG0074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3284
OMA 1 1.010 - - QHG56336
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0003664
OrthoInspector 1 1.000 - - otm24371
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45697
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.