DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and ARF1

DIOPT Version :10

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001649.1 Gene:ARF1 / 375 HGNCID:652 Length:181 Species:Homo sapiens


Alignment Length:164 Identity:81/164 - (49%)
Similarity:112/164 - (68%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWK 79
            :||.|||::|||.|||||||.:|...:|.|..||.|||:::|........|||:|||.||||.|:
Human    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWR 79

  Fly    80 NYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMS 144
            :||.||..||:|:|..||.|:.||..||..||.::.|:...:|:||||||:|:||:|||:.:|:.
Human    80 HYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLG 144

  Fly   145 LVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            |..|:.|.|.|:|..|..|.||.||:||:...::
Human   145 LHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR 178

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 81/160 (51%)