DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and CG11356

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:86/204 - (42%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLL--------------SLLRKLRPNPEKEARILLLGLDNAGKTTILKQLA--SEDITTVTPTA 49
            ||||              |..|...|..| |.::|:||...:|||.:..:|:  |.|......|.
  Fly     1 MGLLCAKLCDCCCYHQTISCCRTSSPAME-EFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATN 64

  Fly    50 G---FNIKSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDC-TDRTRLPEAGSELFEM 110
            |   :.:||......:|.:.::||..:::..||:|:|::..|||..|. .|...:....|.|.:.
  Fly    65 GVRCYRMKSAEEPIAQLQLTEVGGNVEMQRLWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDC 129

  Fly   111 LMDNRLKQVPVLIFANKQ-------DMPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKE 168
            |:..:|...|||:.|::.       |:..|....|:|:......|        .|...:...|..
  Fly   130 LVGTQLAGKPVLLVASRHRVGVQLYDVEYAFGLEELAKSCDCPLL--------ICHMDETEDLHR 186

  Fly   169 GMDWVCKNM 177
            |:.|:|..:
  Fly   187 GIRWLCHQL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 50/199 (25%)
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 25/84 (30%)
P-loop_NTPase 32..194 CDD:304359 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45697
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.