DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl-3

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_497037.1 Gene:arl-3 / 175121 WormBaseID:WBGene00000188 Length:184 Species:Caenorhabditis elegans


Alignment Length:179 Identity:100/179 - (55%)
Similarity:131/179 - (73%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADG-FKLN 64
            |||:.:|:..:....:|.|||||||||||||||||||:|||:..||||.|||:|:|||.| .:||
 Worm     1 MGLIDVLKSFKSPSGREIRILLLGLDNAGKTTILKQLSSEDVQHVTPTKGFNVKTVAAMGDIRLN 65

  Fly    65 VWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQD 129
            |||||||..|||||.||:.|.|.||:|||..|:.|..|...||.|:|.:.:|::|||||||||||
 Worm    66 VWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKLRKVPVLIFANKQD 130

  Fly   130 MPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178
            :..|.|:.|:..|::|..|:.|||.|:||:|:...|:.:|:.||..|:|
 Worm   131 LVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNLK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 96/173 (55%)
arl-3NP_497037.1 Arl3 3..177 CDD:206721 96/173 (55%)
Ras 19..175 CDD:278499 92/155 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164749
Domainoid 1 1.000 195 1.000 Domainoid score I1842
eggNOG 1 0.900 - - E2759_KOG0074
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48276
Inparanoid 1 1.050 205 1.000 Inparanoid score I2428
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56336
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003664
OrthoInspector 1 1.000 - - oto18487
orthoMCL 1 0.900 - - OOG6_104284
Panther 1 1.100 - - LDO PTHR45697
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2406
SonicParanoid 1 1.000 - - X2537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.