DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arc-1

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_496089.3 Gene:arc-1 / 174525 WormBaseID:WBGene00000180 Length:539 Species:Caenorhabditis elegans


Alignment Length:174 Identity:60/174 - (34%)
Similarity:95/174 - (54%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVT---PTAGFNIKSVAADGFKLNVWDIG 69
            |||......|:|::|||||.||||:|:::|....:.||.   ||.||||:::....::||.||:|
 Worm   360 RKLHIGDFIESRVVLLGLDGAGKTSIVRRLKKVQMDTVMAPHPTIGFNIETIHYKNYRLNFWDVG 424

  Fly    70 GQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQD---MP 131
            |..|:|..||:|::|...:.||||.....|..||..||..::.|..:...||::..|::|   :.
 Worm   425 GLPKLRHLWKHYYSNAQAIFYVIDGYAVERFSEAIKELNRVMSDPLVGTCPVIVAVNRKDGYALN 489

  Fly   132 DAMSAAEVAEKMSLVQLQGRTWE--IKACTAVDGTGLKEGMDWV 173
            ..|.|.       |.||:...::  ...|.|..|:|:.:.:|.:
 Worm   490 GHMDAL-------LSQLEALPFQHHFHCCDAATGSGIDQIIDQI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 60/174 (34%)
arc-1NP_496089.3 zf-RING_5 6..54 CDD:291308
zf-B_box 105..149 CDD:279037
Apolipoprotein 201..>306 CDD:279749
BBC 208..339 CDD:128778
Arf_Arl 371..526 CDD:206644 56/161 (35%)
small_GTP 371..526 CDD:272973 56/161 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.