DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl-13

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001032986.1 Gene:arl-13 / 171765 WormBaseID:WBGene00021349 Length:370 Species:Caenorhabditis elegans


Alignment Length:120 Identity:41/120 - (34%)
Similarity:64/120 - (53%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFN-IKSVAADGFKLNVWDIGGQWKIR 75
            |...:|.::...|:.:|||||.||.|..||...:..|.||: :|....:.|.|.::|:||...||
 Worm    19 PIIRREIKLGCFGIGSAGKTTFLKVLKGEDPRDLLRTNGFSTVKMEYDETFHLTIYDVGGDKGIR 83

  Fly    76 PYWKNYFANTDVLIYVID-CTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQD 129
            ..|.||:|....:||||| .||.| ..|:...|..:..:..:::.|:.:..|.|:
 Worm    84 GIWSNYYAEVHGIIYVIDYSTDET-FTESIEALHSLTSNPHVQKKPIFLLLNNQN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 41/120 (34%)
arl-13NP_001032986.1 Gem1 23..>166 CDD:224025 40/116 (34%)
P-loop_NTPase 27..>137 CDD:304359 38/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.