DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and arl3

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_002938771.2 Gene:arl3 / 100492073 XenbaseID:XB-GENE-956688 Length:182 Species:Xenopus tropicalis


Alignment Length:177 Identity:116/177 - (65%)
Similarity:145/177 - (81%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNV 65
            |||||:||||:..|::|.||||||||||||||:|||||||||:.:|||.|||||||.:.||||||
 Frog     1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNV 65

  Fly    66 WDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDM 130
            ||||||.||||||:|||.||||||||||..||.|..|.|.||.|:|.:.:|..|||||||||||:
 Frog    66 WDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDL 130

  Fly   131 PDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNM 177
            ..|..|:|:||.::|..::.|.|:|::|:|:.|.|:::||:|||||:
 Frog   131 LTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 112/172 (65%)
arl3XP_002938771.2 Arl3 3..176 CDD:206721 112/172 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I2274
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H48276
Inparanoid 1 1.050 242 1.000 Inparanoid score I3236
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0003664
OrthoInspector 1 1.000 - - otm48576
Panther 1 1.100 - - LDO PTHR45697
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.