DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARL3

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_015274.1 Gene:ARL3 / 856056 SGDID:S000005972 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:50/172 - (29%)
Similarity:93/172 - (54%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESK---ESNNQVSEWSFTI---NNFRVQLWDINGELKNRQI 81
            :||||||||||:|..:.|.:.::...|   :....|.:...||   :...::.||:.|:...|.:
Yeast    20 ILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSM 84

  Fly    82 WPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDL 146
            |.:||...:.:||::||:|..||.|....|..|:|.:|::..|:|:::||:|....:.:..:.::
Yeast    85 WSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEV 149

  Fly   147 MG--LYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNRK 186
            ..  ...::.||......|..||.||::.:.|:..::..|:|
Yeast   150 FNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 48/164 (29%)
Ras 23..183 CDD:278499 48/167 (29%)
ARL3NP_015274.1 Arfrp1 19..185 CDD:206725 48/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.