DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARFD1B

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_171745.3 Gene:ARFD1B / 839242 AraportID:AT1G02430 Length:190 Species:Arabidopsis thaliana


Alignment Length:177 Identity:44/177 - (24%)
Similarity:86/177 - (48%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QKSCLLILGLDNAGKSTLTDRLAEIFNGESKES-----NNQVSEWSFTINNFRVQLWDINGELKN 78
            ::|.:::.|||.||||::..:|.   .||:..:     ...|....:..:|.|  .|::.|:   
plant    16 EESRIVLFGLDAAGKSSIMHKLK---TGETLTTTMPTIGTDVESVKYKDSNLR--FWEMGGQ--- 72

  Fly    79 RQIWPKY------YKKVNVLIFVLDSTDALRLSEARCVL---CDVLMHQELDNAPLLIVSNKKDA 134
             |.:..:      ::::..|:.|:||||..|:.:|:..|   .|.:.....||..:|:..||.:.
plant    73 -QCYKWFPMTKHDFQEIAGLVLVVDSTDRDRIEDAKDFLNAVIDEIQGSVPDNVAVLVFGNKHEV 136

  Fly   135 SGSLSMSTV---IDLMGLYRLT-GRDWTFEECSMRTGSGVQEIVNWI 177
            .|::|.|.:   :||..|.:.. .|:|..:.....:|.|:.|.::|:
plant   137 PGAMSASEISNKLDLTSLRQKNWQRNWHVQSSCAFSGDGLHEGLDWL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 43/174 (25%)
ARFD1BNP_171745.3 Arf_Arl 19..186 CDD:206644 43/174 (25%)

Return to query results.
Submit another query.