DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARFA1B

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001318560.1 Gene:ARFA1B / 831319 AraportID:AT5G14670 Length:188 Species:Arabidopsis thaliana


Alignment Length:175 Identity:60/175 - (34%)
Similarity:95/175 - (54%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWDINGELK 77
            :|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:       ||:.|:.|
plant    20 ILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV-------WDVGGQDK 73

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|.:|..|::....||||:||.|..|:.|||..|..:|...||.:|.||:.:||:|...:::.:.
plant    74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAE 138

  Fly   143 VIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINE----KINN 183
            :.|.:||:.|..|.|..:.....:|.|:.|.::|::.    |:||
plant   139 ITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATKVNN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/170 (34%)
ARFA1BNP_001318560.1 PLN00223 1..180 CDD:165788 57/170 (34%)

Return to query results.
Submit another query.