DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARFA1E

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_191788.1 Gene:ARFA1E / 825402 AraportID:AT3G62290 Length:181 Species:Arabidopsis thaliana


Alignment Length:171 Identity:59/171 - (34%)
Similarity:93/171 - (54%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWDINGELK 77
            :|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:       ||:.|:.|
plant    20 ILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV-------WDVGGQDK 73

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|.:|..|::....||||:||.|..|:.|||..|..:|...||.:|.||:.:||:|...:::.:.
plant    74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAE 138

  Fly   143 VIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINN 183
            :.|.:||:.|..|.|..:.....:|.|:.|.::|::..|.|
plant   139 ITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/166 (34%)
ARFA1ENP_191788.1 PLN00223 1..181 CDD:165788 59/171 (35%)

Return to query results.
Submit another query.