DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Trim23

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_008758905.1 Gene:Trim23 / 81002 RGDID:621587 Length:601 Species:Rattus norvegicus


Alignment Length:189 Identity:63/189 - (33%)
Similarity:104/189 - (55%) Gaps:24/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PVSFIK--KILPAGSQKSCLLILGLDNAGKSTLTDRLAEI----------FNGESKESNNQVSEW 58
            ||:|.|  ::......:..::.||||.|||:|:..:|.:.          ||.|:.|..|    .
  Rat   415 PVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKN----L 475

  Fly    59 SFTINNFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNA 123
            .|||       ||:.|:.|.|.:|..||.....::||:||:...|:|||...|..:|..:||.:|
  Rat   476 KFTI-------WDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDA 533

  Fly   124 PLLIVSNKKDASGSLSMSTVIDLMGLYRL-TGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            .|||.:||:|.:|:||:..:.:|:.|::| .||.|..:.|..|:|.|:.|.::|::.::
  Rat   534 LLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 59/168 (35%)
Ras 23..183 CDD:278499 59/170 (35%)
Trim23XP_008758905.1 zf-RING_UBOX 58..100 CDD:290181
BBOX 152..195 CDD:237988
BBOX 200..246 CDD:197662
BBC 253..397 CDD:128778
ARD1 433..601 CDD:206723 59/171 (35%)
Ras 433..592 CDD:278499 59/169 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.