DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl5b

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_083742.3 Gene:Arl5b / 75869 MGIID:1923119 Length:179 Species:Mus musculus


Alignment Length:168 Identity:50/168 - (29%)
Similarity:84/168 - (50%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQKSCLLILGLDNAGKSTLTDRLAEIFNGE----SKESNNQVSEWSFTINNFRVQLWDINGELKN 78
            :|:..::|:|||||||:|:   |.:....|    |....:.|.|  ..:.|....:|||.|:...
Mouse    14 NQEHKVIIVGLDNAGKTTI---LYQFLMNEVVHTSPTIGSNVEE--IVVKNTHFLMWDIGGQESL 73

  Fly    79 RQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTV 143
            |..|..||.....:|.|:||.|..||:..:..|..:|.|::|..|.:||.:||:|..|.::.:.:
Mouse    74 RSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEI 138

  Fly   144 IDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            ...:.|..:....|..:.|...||.|:.:.:.|:..:|
Mouse   139 SKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 48/161 (30%)
Ras 23..183 CDD:278499 49/163 (30%)
Arl5bNP_083742.3 Arl5_Arl8 3..175 CDD:133353 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.