DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl9

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001038852.1 Gene:arl9 / 751670 ZFINID:ZDB-GENE-060825-210 Length:241 Species:Danio rerio


Alignment Length:188 Identity:55/188 - (29%)
Similarity:94/188 - (50%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AGSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKESN-------NQVSEWSFTIN--NFRVQLWD 71
            ||:|   :|:||||.|||::    |...|...|.|.:       |.||     ||  :.:::..:
Zfish    72 AGTQ---VLVLGLDGAGKTS----LLHCFATGSLEQDVSPTQGFNAVS-----INKEDLQIEFLE 124

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNA----PLLIVSNKK 132
            |.|..|.|:.|..|..|..||:||:||:|..|...|:..|      |:|.:|    ||::::||:
Zfish   125 IGGSEKLREYWRMYLSKARVLVFVVDSSDPERFPLAKHHL------QQLLSADPGLPLVLLANKQ 183

  Fly   133 DASGSLSMSTVIDLMGL------YRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNN 184
            |.||:..::.:.:.:.|      ::|:......::......:|||:..:.|.|.:.|:
Zfish   184 DVSGARGITDLYEALDLGNVGDGHQLSVIGTQVKKGKCEINAGVQDARDLIIEMMANH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 50/176 (28%)
Ras 23..183 CDD:278499 51/178 (29%)
arl9NP_001038852.1 P-loop_NTPase 75..239 CDD:304359 52/181 (29%)
Gem1 75..>184 CDD:224025 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.