DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Sar1b

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_079811.1 Gene:Sar1b / 66397 MGIID:1913647 Length:198 Species:Mus musculus


Alignment Length:191 Identity:52/191 - (27%)
Similarity:89/191 - (46%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YGPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTINNFRVQ 68
            |...|.:.:.|....:...|:.||||||||:||...|.:...|:...:.:..|| ..||......
Mouse     9 YSGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSE-ELTIAGMTFT 72

  Fly    69 LWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKD 133
            .:|:.|.::.|::|..|...:|.::|::|..|..||.|::..|..::..:.:.|.|:||:.||.|
Mouse    73 TFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKID 137

  Fly   134 ASGSLSMSTVIDLMGLY------------RLTGRDWTFEECSMRTGSGVQEIVNWINEKIN 182
            ...::|...:.::.|||            .|..|......||:....|..|...|:.:.|:
Mouse   138 RPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 48/169 (28%)
Sar1bNP_079811.1 Sar1 3..197 CDD:206645 51/188 (27%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.