DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl14

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001093453.1 Gene:arl14 / 556921 ZFINID:ZDB-GENE-070705-288 Length:201 Species:Danio rerio


Alignment Length:189 Identity:57/189 - (30%)
Similarity:92/189 - (48%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEI----------FNGESKESNNQVSEWSFTINNFRVQLWDINGELK 77
            :|:|||||||||||..:|...          ||.|..|:.....:.|.|:       ||:.|:.|
Zfish    14 ILLLGLDNAGKSTLLYKLKYDENFHTVPTIGFNVEMIEAKKNRDKISLTV-------WDVGGQAK 71

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|..|..:|:....::||:||:|..||.||:.||...|..:.|...|:::::||:|..|:.:::.
Zfish    72 MRAFWRNFYQDTAGIVFVVDSSDVKRLDEAKGVLEQSLRSEHLRGLPVVVLANKQDIVGAATVTE 136

  Fly   143 VIDLMGLYR-LTGRDWTFEECSMRTGSG--------------------VQEIVNWINEK 180
            :.:...|.: .:.|||..:.||..||:|                    ::|.|.:|..|
Zfish   137 ITEQFNLRKSCSDRDWFIQPCSALTGAGLVDGFRRMAHLVKMTPDDNNIKETVKYIRAK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 56/187 (30%)
Ras 23..183 CDD:278499 57/189 (30%)
arl14NP_001093453.1 SAR 11..176 CDD:197556 53/168 (32%)
P-loop_NTPase 13..175 CDD:304359 53/167 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.