DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl14

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001015791.1 Gene:arl14 / 548508 XenbaseID:XB-GENE-5750500 Length:201 Species:Xenopus tropicalis


Alignment Length:171 Identity:47/171 - (27%)
Similarity:92/171 - (53%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTI------NNFRVQLWDINGELKNRQI 81
            :||||||:|||||:      ::..:.||....:....|.:      .:.::.:||:.|:.|.|..
 Frog    16 ILILGLDDAGKSTV------LYKFKFKEPFITIPTVGFNVEMIHTEKHLQLTMWDVGGQQKLRSF 74

  Fly    82 WPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDL 146
            |..|::..:.|::|:||.|:..|.|::.....||.::.:.:.|:::::||:|..|:|:...:...
 Frog    75 WCHYFENTDGLVYVVDSNDSKHLDESKKEFQHVLQNELIKDVPVVLLANKQDLPGALNAEEITRK 139

  Fly   147 MGLYR-LTGRDWTFEECSMRTGSGVQEIVNWINEKINNNRK 186
            ..:.: .:.|||..:.|...||.|:.|.::.:.|.:.|..|
 Frog   140 FNMKKYCSDRDWYVQPCCAHTGQGLAEGLSKVTEFVKNCMK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 44/163 (27%)
Ras 23..183 CDD:278499 45/166 (27%)
arl14NP_001015791.1 ARLTS1 15..174 CDD:133356 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.