DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Sar1

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:87/172 - (50%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTINNFRVQLWDINGELKNRQIWPKYYK 87
            ||.||||||||:||...|.:....:...:.:..|| ..:|.|.|...:|:.|..:.|::|..|:.
  Fly    23 LLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSE-ELSIGNMRFTTFDLGGHTQARRVWKDYFP 86

  Fly    88 KVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLMGLYRL 152
            .|:.::|::|:.|..|..|::..|..:|..:.|.|.|:||:.||.|..|:.|...:.::.|||:|
  Fly    87 AVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNVFGLYQL 151

  Fly   153 T------------GRDWTFEECSMRTGSGVQEIVNWINEKIN 182
            |            ||......||:....|..|...|:.:.|:
  Fly   152 TTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYID 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 53/168 (32%)
Ras 23..183 CDD:278499 54/172 (31%)
Sar1NP_732717.1 Sar1 2..192 CDD:206645 53/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.