DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl10

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_989044.1 Gene:arl10 / 394641 XenbaseID:XB-GENE-945631 Length:237 Species:Xenopus tropicalis


Alignment Length:178 Identity:54/178 - (30%)
Similarity:92/178 - (51%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PAGSQKSCL----LILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTINNFRVQLWDINGE 75
            ||..|...|    |:||||.||||::...::......|....:..:.........|::|.::.|.
 Frog    36 PATEQVKYLDRQILVLGLDGAGKSSIIHAISTNTTRSSSAPTHGFNSAQIIHQGLRIELLEVGGS 100

  Fly    76 LKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSM 140
            ...|..|.:|.|..||::||:||||..||..||..| ..|:| |..:.||::::||:|.:.:|.:
 Frog   101 QNLRTYWSQYLKNANVIVFVVDSTDNKRLHLARQEL-HRLLH-EAPDLPLMVLANKQDQNTALCL 163

  Fly   141 STVIDLMGLYRLTG-RDWTFEECS-MRTGSG----VQEIVNWINEKIN 182
            ..:...:.|:|:|| |:.|....| :..|:|    :|.:...:.|:::
 Frog   164 PEIHSELSLHRITGEREVTLLGTSAVSDGAGHSTRLQTVKTLLEERLH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 50/167 (30%)
Ras 23..183 CDD:278499 51/170 (30%)
arl10NP_989044.1 P-loop_NTPase 47..210 CDD:328724 50/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.