DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arf5

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_989018.1 Gene:arf5 / 394614 XenbaseID:XB-GENE-968852 Length:181 Species:Xenopus tropicalis


Alignment Length:179 Identity:59/179 - (32%)
Similarity:101/179 - (56%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:       ||
 Frog    14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|::|||..|..:|...||.:|.||:.:||:|...
 Frog    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNR 185
            :::.:.:.|.:||:.|..|:|..:.....:|.|:.|.::|::.::.|::
 Frog   133 AMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNHK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/167 (34%)
Ras 23..183 CDD:278499 57/169 (34%)
arf5NP_989018.1 ARF 5..179 CDD:128474 58/175 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.