DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARL13A

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001155963.1 Gene:ARL13A / 392509 HGNCID:31709 Length:256 Species:Homo sapiens


Alignment Length:163 Identity:49/163 - (30%)
Similarity:89/163 - (54%) Gaps:12/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ILGLDNAGKSTLTDRLAEIFNGESKESNNQVSE-WSFTINNFRVQLWDINGELKNRQIWPKYYKK 88
            |:||:|:||:.|.:...::.  .||..:...|| .:..::.:.:.::|:||:||.|:.||.||.:
Human    26 IIGLNNSGKTVLVEAFQKLL--PSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQ 88

  Fly    89 VNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLMGLYRLT 153
            .:.|:|||||:|..|:.|.:.:|..:|..:.:...|:||::||:|...:|....:||.:.|.:|.
Human    89 AHGLVFVLDSSDIRRMQEVKIILTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLV 153

  Fly   154 GRD---WTFEECS------MRTGSGVQEIVNWI 177
            ..:   ...|.||      .|....:.|.:.|:
Human   154 KENKCPCRVEPCSAIRNLERRNHQPIVEGLRWL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 49/163 (30%)
Ras 23..183 CDD:278499 49/163 (30%)
ARL13ANP_001155963.1 Arl2l1_Arl13_like 23..189 CDD:133361 49/163 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3213
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.