DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARF5

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001653.1 Gene:ARF5 / 381 HGNCID:658 Length:180 Species:Homo sapiens


Alignment Length:176 Identity:55/176 - (31%)
Similarity:94/176 - (53%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    ..||:       ||
Human    14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ICFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|:.|:...|..:|...||.:|.||:.:||:|...
Human    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKIN 182
            ::.:|.:.|.:||..|..|.|..:......|:|:.:.::|::.:::
Human   133 AMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 54/167 (32%)
ARF5NP_001653.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 55/176 (31%)

Return to query results.
Submit another query.