DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARF1

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001649.1 Gene:ARF1 / 375 HGNCID:652 Length:181 Species:Homo sapiens


Alignment Length:179 Identity:59/179 - (32%)
Similarity:100/179 - (55%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:       ||
Human    14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|::|||..|..:|...||.:|.||:.:||:|...
Human    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNR 185
            :::.:.:.|.:||:.|..|:|..:.....:|.|:.|.::|::.::.|.:
Human   133 AMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/167 (34%)
ARF1NP_001649.1 Important for the stable binding to the membranes. /evidence=ECO:0000250|UniProtKB:P84080 3..16 1/1 (100%)
ARF 5..179 CDD:128474 58/175 (33%)

Return to query results.
Submit another query.