DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl6

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:189 Identity:52/189 - (27%)
Similarity:91/189 - (48%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKKILPAGSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTINNF-------RV 67
            |||      .|..:|:|||:|:|||::.:.    |...|::::..|....|.:..|       .:
  Fly    13 IKK------DKMTILVLGLNNSGKSSIINH----FKKSSEQTSIVVPTVGFMVEQFYIGMSGVSI 67

  Fly    68 QLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDN--APLLIVSN 130
            :..|::|..:.|.:|...:|..:.:|:|:||:|.:|....:..|..||.|.:|.|  .|:|...|
  Fly    68 KAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGN 132

  Fly   131 KKDASGSLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKIN----NNR 185
            |.|...|||...:...:.|..:..:.|.....|..:|.|:.|.|.|:.:::.    ||:
  Fly   133 KMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 46/166 (28%)
Ras 23..183 CDD:278499 46/172 (27%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 46/166 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.