DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl5b

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001015031.2 Gene:Arl5b / 364788 RGDID:1305569 Length:180 Species:Rattus norvegicus


Alignment Length:168 Identity:50/168 - (29%)
Similarity:84/168 - (50%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQKSCLLILGLDNAGKSTLTDRLAEIFNGE----SKESNNQVSEWSFTINNFRVQLWDINGELKN 78
            :|:..::|:|||||||:|:   |.:....|    |....:.|.|  ..:.|....:|||.|:...
  Rat    15 NQEHKVIIVGLDNAGKTTI---LYQFLMNEVVHTSPTIGSNVEE--IVVKNTHFLMWDIGGQESL 74

  Fly    79 RQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTV 143
            |..|..||.....:|.|:||.|..||:..:..|..:|.|::|..|.:||.:||:|..|.::.:.:
  Rat    75 RSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDLKGCMTAAEI 139

  Fly   144 IDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            ...:.|..:....|..:.|...||.|:.:.:.|:..:|
  Rat   140 SKYLTLSSIRDHPWHIQSCCALTGEGLCQGLEWMTSRI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 48/161 (30%)
Ras 23..183 CDD:278499 49/163 (30%)
Arl5bNP_001015031.2 Arl5_Arl8 4..176 CDD:133353 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.