DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl6

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006248253.1 Gene:Arl6 / 363760 RGDID:1305535 Length:193 Species:Rattus norvegicus


Alignment Length:169 Identity:54/169 - (31%)
Similarity:90/169 - (53%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSE----WSFTINNFR-----VQLWDINGELKN 78
            :|.|||||:||:|:.::|        |.||.||.:    ..|:|..|:     ..::|::|:.:.
  Rat    20 VLCLGLDNSGKTTIINKL--------KPSNAQVQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRY 76

  Fly    79 RQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDN--APLLIVSNKKDASGSLSMS 141
            |.:|..|||....:|||:||:|.||:..|:..|..:|.|.::.:  .|:|..:||.|...:::..
  Rat    77 RNLWEHYYKDGQAIIFVVDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSV 141

  Fly   142 TVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEK 180
            .|..|:.|..:..:.|.........|.|:||.|:|:.||
  Rat   142 KVSQLLCLENIKDKPWHICASDALKGEGLQEGVDWLQEK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 52/167 (31%)
Ras 23..183 CDD:278499 54/169 (32%)
Arl6XP_006248253.1 SAR 11..179 CDD:197556 52/166 (31%)
Arl6 19..180 CDD:206722 52/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.