DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and zgc:77650

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_956170.1 Gene:zgc:77650 / 334219 ZFINID:ZDB-GENE-030131-6151 Length:180 Species:Danio rerio


Alignment Length:176 Identity:56/176 - (31%)
Similarity:96/176 - (54%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    ..||:       ||
Zfish    14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ICFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|::|:...|..:|...||.:|.||:.:||:|...
Zfish    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVAESAEELSKMLQEDELRDAVLLVFANKQDLPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKIN 182
            ::::|.:.|.:||..|..|.|..:......|:|:.|.::|::.:::
Zfish   133 AMAVSELTDKLGLQSLRSRTWYVQATCATQGTGLYEGLDWLSNELS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 55/167 (33%)
Ras 23..183 CDD:278499 55/170 (32%)
zgc:77650NP_956170.1 YlqF_related_GTPase 1..180 CDD:424112 56/176 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.