DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and CG13692

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:57/115 - (49%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELD-NAPLLIVSN 130
            :|:.:|.|.:  ..:|.:|::.|..||:|:|:::..::|.|..:...:|....|. |..:|:|..
  Fly    78 IQILEIGGSM--APLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHNTKILLVLA 140

  Fly   131 KKDASGSLSMSTVIDLMGLYRL---TGRDWTFEECSMRTGSGVQEIVNWI 177
            |.|.|.....:..:.::.:.:|   ..:..|..|.|..|..|:..|.:|:
  Fly   141 KMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 28/115 (24%)
CG13692NP_608523.1 P-loop containing Nucleoside Triphosphate Hydrolases 4..191 CDD:476819 28/115 (24%)

Return to query results.
Submit another query.