DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl11

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_955987.1 Gene:arl11 / 324689 ZFINID:ZDB-GENE-030131-3410 Length:176 Species:Danio rerio


Alignment Length:160 Identity:53/160 - (33%)
Similarity:83/160 - (51%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDR-LAEI---------FNGESKESNNQVSEWSFTINNFRVQLWDINGELK 77
            :||:|||:||||||..| |..:         ||..:.:.|.:.|          :.:|||.|:..
Zfish    15 VLIMGLDSAGKSTLMYRQLHGVIMQTSPTVGFNVATLQLNKKTS----------LTVWDIGGQDT 69

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|..|..|.:...||:||:||:|..|:.||:..|..:|..:.|...||::::||||...::::..
Zfish    70 MRPNWKYYLEGCKVLVFVVDSSDYARIGEAQKALKKILHDEHLKGVPLMVLANKKDLPNTMTIRE 134

  Fly   143 VIDLMGLYRLTGRDWTFEECSMRTGSGVQE 172
            |...:.|...|.|.|..:.||...|.|:|:
Zfish   135 VSTKLDLDTYTDRQWEIQACSAVKGLGLQQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 53/160 (33%)
Ras 23..183 CDD:278499 53/160 (33%)
arl11NP_955987.1 small_GTP 12..166 CDD:272973 53/160 (33%)
ARLTS1 14..172 CDD:133356 53/160 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.