DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arfrp1

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:191 Identity:54/191 - (28%)
Similarity:93/191 - (48%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQKS--CLLILGLDNAGKSTLTDRLAEIFNGESKESNNQ-------VSEWSFTINNFRVQLWDIN 73
            :||.  |::|||||||||:|..:.....|....|..|..       ::..:..:...|:..||:.
  Fly    13 TQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLG 77

  Fly    74 GELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSL 138
            |:.:.:.:|.|||::.:.:|:|:||.|..|:.|::.:...::.::.|...||||::||:|     
  Fly    78 GQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQD----- 137

  Fly   139 SMSTVIDLMGLYR----------LTGRDWTFEEC-----SMRTGSGVQEIVNWINEKINNN 184
                :.|:||:..          |.||    .:|     |...|.||.|.:.|:.|.|..:
  Fly   138 ----LPDVMGVREIKPVFQQAGALIGR----RDCLTIPVSALHGEGVDEGIKWLVEAIKRH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 50/179 (28%)
Ras 23..183 CDD:278499 51/181 (28%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 49/176 (28%)
Arfrp1 19..186 CDD:206725 50/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.