DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl4d

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001100522.1 Gene:Arl4d / 303559 RGDID:1306875 Length:201 Species:Rattus norvegicus


Alignment Length:175 Identity:53/175 - (30%)
Similarity:87/175 - (49%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTINNFRV----------QLWDINGELK 77
            ::::|||:|||::|..||      :.||....|....|.....||          |:||:.|:.|
  Rat    24 VVVIGLDSAGKTSLLYRL------KFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEK 82

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|.:|..|.::.:.|:||:||.:..||.|||..|..:....:....|:|:::||:|..|:||.:.
  Rat    83 LRPLWRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAE 147

  Fly   143 VIDLMGLYRLTGRDWT-FEECSMRTGSGVQEIVNWINEKINNNRK 186
            |...:.:..|.....| .:.||...|.|:|..:..:.|.|...:|
  Rat   148 VEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEMILKRKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 50/167 (30%)
Ras 23..183 CDD:278499 52/170 (31%)
Arl4dNP_001100522.1 Arl4_Arl7 19..201 CDD:206719 53/175 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.