DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl9

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017454588.1 Gene:Arl9 / 289565 RGDID:1303337 Length:780 Species:Rattus norvegicus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:78/170 - (45%) Gaps:35/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLILGLDNAGKSTLTDRLAEI-----------FNGESKESNNQVSEWSFTINNFRVQLWDINGEL 76
            :|:||||.|||:::...||..           ||..:..|.::           :::..:|.|..
  Rat   614 ILVLGLDGAGKTSVLHFLASNTVRHSTAPTLGFNAVNISSEDR-----------QMEFLEIGGSE 667

  Fly    77 KNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELD---NAPLLIVSNK-KDASGS 137
            ..|..|..|..|..:||||:||.|..||.||:..|     ||.:|   :.||::.:|| ||...:
  Rat   668 PFRSYWDMYLPKGWLLIFVVDSADHKRLPEAKKYL-----HQLIDPNPDLPLVVFANKQKDLEAA 727

  Fly   138 LSMSTVIDLMGLYRLTGRD---WTFEECSMRTGSGVQEIV 174
            ..::.:.|.:.|..: |.|   :.|.....|.||.:..|:
  Rat   728 YRITDIHDALALSDV-GNDRKLFLFGTQVTRNGSEIPSIM 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 49/170 (29%)
Ras 23..183 CDD:278499 49/170 (29%)
Arl9XP_017454588.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.