DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and ARL5A

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_036229.1 Gene:ARL5A / 26225 HGNCID:696 Length:179 Species:Homo sapiens


Alignment Length:165 Identity:53/165 - (32%)
Similarity:88/165 - (53%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QKSCLLILGLDNAGKSTLTDRLA--EIFNGESKESNNQVSEWSFTINNFRVQLWDINGELKNRQI 81
            |:..::|:|||||||:|:..:.:  |:.: .|....:.|.|  ..|||.|..:|||.|:...|..
Human    15 QEHKVIIVGLDNAGKTTILYQFSMNEVVH-TSPTIGSNVEE--IVINNTRFLMWDIGGQESLRSS 76

  Fly    82 WPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDL 146
            |..||.....:|.|:||||..|:|..|..|..:|.|::|..|.|||.:||:|....::::.:...
Human    77 WNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQF 141

  Fly   147 MGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            :.|..:....|..:.|...||.|:.:.:.|:..::
Human   142 LKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 52/159 (33%)
Ras 23..183 CDD:278499 52/161 (32%)
ARL5ANP_036229.1 Arl5_Arl8 3..175 CDD:133353 53/162 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.