DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl5c

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_997114.1 Gene:Arl5c / 217151 MGIID:3028577 Length:179 Species:Mus musculus


Alignment Length:172 Identity:52/172 - (30%)
Similarity:83/172 - (48%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKES----NNQVSEWSFTINNFRVQLWDINGELK 77
            |||:..::|:|||||||:|:   |.:....|...:    .:.|.|  ..:......:||:.|:..
Mouse    13 GSQEHKVIIVGLDNAGKTTI---LYQFLTNEVVHTCSTIGSNVEE--IVLRKTHFLMWDLGGQEA 72

  Fly    78 NRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMST 142
            .|..|..||.....:|.|:||||..||...|..|..:|.|:.|.||.:||.:||:|...|::.:.
Mouse    73 LRSTWDTYYSNAEFVILVIDSTDRNRLLTTREELYKMLAHEALQNASVLIFANKQDVKDSMTTAE 137

  Fly   143 VIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNN 184
            :...:.|..:....|..:.|...||.|:...:.|:..:...|
Mouse   138 ISQFLTLSAIKDHPWHIQGCCALTGEGLPAGLQWMQAQATAN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 48/161 (30%)
Ras 23..183 CDD:278499 48/163 (29%)
Arl5cNP_997114.1 Arl5_Arl8 3..172 CDD:133353 50/163 (31%)
Gem1 18..>138 CDD:224025 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.