DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arl-3

DIOPT Version :9

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_497037.1 Gene:arl-3 / 175121 WormBaseID:WBGene00000188 Length:184 Species:Caenorhabditis elegans


Alignment Length:179 Identity:51/179 - (28%)
Similarity:88/179 - (49%) Gaps:12/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTI------N 63
            |.:..:|.......::..:|:||||||||:|:..:|:      |::..:......|.:      .
 Worm     2 GLIDVLKSFKSPSGREIRILLLGLDNAGKTTILKQLS------SEDVQHVTPTKGFNVKTVAAMG 60

  Fly    64 NFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIV 128
            :.|:.:|||.|:...|..|..||:.::.||||:||.|..|..|....|.::|..::|...|:||.
 Worm    61 DIRLNVWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKLRKVPVLIF 125

  Fly   129 SNKKDASGSLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWI 177
            :||:|...:.|...:...:.|..|..|.|..:.||.....|:.:.:.|:
 Worm   126 ANKQDLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 49/162 (30%)
Ras 23..183 CDD:278499 49/161 (30%)
arl-3NP_497037.1 Arl3 3..177 CDD:206721 50/178 (28%)
Ras 19..175 CDD:278499 49/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.